PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa04g051770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family MYB
Protein Properties Length: 302aa    MW: 33415.9 Da    PI: 5.0648
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa04g051770.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.38.2e-092873346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE +++ +a + + ++   +W ++a +++ g+t  +++  ++ 
   Csa04g051770.1 28 KWTAEENKKFENALAFYDKDtpdRWVKVADMLP-GKTVGDVIKQYRE 73
                     8********************************.******9999986 PP

2Myb_DNA-binding48.51.9e-15145189347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ Iar + ++Rt+ q+ s+ qky
   Csa04g051770.1 145 PWTEEEHRQFLMGLKKYGKGDWRNIARNFVTTRTPTQVASHAQKY 189
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-42374IPR009057Homeodomain-like
PROSITE profilePS512939.712479IPR017884SANT domain
SMARTSM007171.5E-102577IPR001005SANT/Myb domain
SuperFamilySSF466899.33E-122781IPR009057Homeodomain-like
CDDcd001673.05E-82874No hitNo description
PfamPF002494.5E-72873IPR001005SANT/Myb domain
PROSITE profilePS5129421.845138194IPR017930Myb domain
SuperFamilySSF466891.73E-17140193IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-18141193IPR006447Myb domain, plants
SMARTSM007178.7E-14142192IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-13142189IPR009057Homeodomain-like
CDDcd001671.15E-11145190No hitNo description
PfamPF002497.9E-13145189IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MNRGIEVMSP ATYLETSNWL FQENRGTKWT AEENKKFENA LAFYDKDTPD RWVKVADMLP  60
GKTVGDVIKQ YRELEEDVSD IEAGLIPIPG YASDSFTLDW GGYDGAAAAG NNGFNMNGYY  120
FSATAGGKRG SAARTAEHER KKGVPWTEEE HRQFLMGLKK YGKGDWRNIA RNFVTTRTPT  180
QVASHAQKYF IRQVNGGKDK RRSSIHDITT VNIPDSPDAA ATDNVTANAP CSPPSVGGSQ  240
QEASEWDGQP LYDETAAAFY NQNGFQETLL GMSSTPYMAK LQEQSFLNAS QFGSYNAYLQ  300
M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-172693875RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1181350.0AK118135.1 Arabidopsis thaliana At2g38090 mRNA for putative MYB family transcription factor, complete cds, clone: RAFL19-43-J04.
GenBankAY5195290.0AY519529.1 Arabidopsis thaliana MYB transcription factor (At2g38090) mRNA, complete cds.
GenBankBT0061220.0BT006122.1 Arabidopsis thaliana clone U50930 putative MYB family transcription factor (At2g38090) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010505420.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-98DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLR0FXY90.0R0FXY9_9BRAS; Uncharacterized protein
STRINGAT2G38090.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.10.0MYB family protein